CDS

Accession Number TCMCG014C08692
gbkey CDS
Protein Id GAY40382.1
Location complement(join(323092..323181,323372..323485,323563..323745))
Organism Citrus unshiu
locus_tag CUMW_051490

Protein

Length 128aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJDB5882, BioSample:SAMD00083908, Sequence Read Archive:DRR142810, DRR142811, DRR142812, DRR142818,, DRR142819, DRR142820, DRR142821, DRR142822
db_source BDQV01000011.1
Definition hypothetical protein CUMW_051490 [Citrus unshiu]
Locus_tag CUMW_051490

EGGNOG-MAPPER Annotation

COG_category J
Description Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko03012        [VIEW IN KEGG]
ko04147        [VIEW IN KEGG]
KEGG_ko ko:K03249        [VIEW IN KEGG]
EC -
KEGG_Pathway ko03013        [VIEW IN KEGG]
map03013        [VIEW IN KEGG]
GOs GO:0000003        [VIEW IN EMBL-EBI]
GO:0003006        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005515        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005829        [VIEW IN EMBL-EBI]
GO:0005852        [VIEW IN EMBL-EBI]
GO:0006412        [VIEW IN EMBL-EBI]
GO:0006413        [VIEW IN EMBL-EBI]
GO:0006518        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0007275        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009058        [VIEW IN EMBL-EBI]
GO:0009059        [VIEW IN EMBL-EBI]
GO:0009743        [VIEW IN EMBL-EBI]
GO:0009744        [VIEW IN EMBL-EBI]
GO:0009790        [VIEW IN EMBL-EBI]
GO:0009791        [VIEW IN EMBL-EBI]
GO:0009793        [VIEW IN EMBL-EBI]
GO:0009846        [VIEW IN EMBL-EBI]
GO:0009856        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010033        [VIEW IN EMBL-EBI]
GO:0010154        [VIEW IN EMBL-EBI]
GO:0010467        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0022414        [VIEW IN EMBL-EBI]
GO:0031369        [VIEW IN EMBL-EBI]
GO:0032501        [VIEW IN EMBL-EBI]
GO:0032502        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0034285        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0034645        [VIEW IN EMBL-EBI]
GO:0042221        [VIEW IN EMBL-EBI]
GO:0043043        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043603        [VIEW IN EMBL-EBI]
GO:0043604        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044249        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044271        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0044706        [VIEW IN EMBL-EBI]
GO:0048316        [VIEW IN EMBL-EBI]
GO:0048608        [VIEW IN EMBL-EBI]
GO:0048731        [VIEW IN EMBL-EBI]
GO:0048856        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0051704        [VIEW IN EMBL-EBI]
GO:0061458        [VIEW IN EMBL-EBI]
GO:0071541        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1901566        [VIEW IN EMBL-EBI]
GO:1901576        [VIEW IN EMBL-EBI]
GO:1901700        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGATGGTTGGTATCCTGATGGGCATGCAATTGAATAACAAAAGTTTTATCGTGATGGCAGTCGATATTCTGAAGTCAACATCGGTTGACAAACTCCCTAGTGATTTGGAAGGAATGGAAGTCCTGATGGAACGGCTACTAACTCTTATTAACGATATCTACAAATATGTTGATGACACTGTGGAAGGGCGTGCTGTACCTGATAATAGTGTAGGGCGTATTCTTTCAGAGACTGTAGCCTCCCTTCCCAAACTGTCACCTCCAGCTTTTGACAAGCTTGTAAATGACAGCCTACAGGACCAGTTGCTCTTGCTATATTTGTCAAGTATCACCAGGACCCAGCTCAGCTTAGCAGAAAAGTTGAACACTGCTGCTCAGATGCCATAA
Protein:  
MMVGILMGMQLNNKSFIVMAVDILKSTSVDKLPSDLEGMEVLMERLLTLINDIYKYVDDTVEGRAVPDNSVGRILSETVASLPKLSPPAFDKLVNDSLQDQLLLLYLSSITRTQLSLAEKLNTAAQMP